PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00005690001
Common NameGSBRNA2T00005690001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 213aa    MW: 22462 Da    PI: 9.013
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00005690001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.92e-372484262
               zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                         ++++l+cprC+stntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++PvGg +rk  k+s
  GSBRNA2T00005690001 24 QQEQLPCPRCESTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPVGGVSRKTSKRS 84
                         68999***************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-32282IPR003851Zinc finger, Dof-type
PfamPF027018.4E-332682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5842882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MPSDLNASCR VTTKLPHGGA AAEQQEQLPC PRCESTNTKF CYYNNYNFSQ PRHFCKSCRR  60
YWTHGGTLRD IPVGGVSRKT SKRSRAFSSV AAAGSRNFPL QATPVLFPPS SYGGGKGNTS  120
SLYGGFTTLL GNNAAASRDG PGGGFNGPEG FGLGLGHGLY LDDVRFGQGI TAWPFSTGAT  180
DAATSHVVPI HATWQLEGTE SRVGFVAGDY LA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.253791e-115flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00005690001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009112344.11e-153PREDICTED: dof zinc finger protein DOF5.8
SwissprotQ9FGD61e-104DOF58_ARATH; Dof zinc finger protein DOF5.8
TrEMBLA0A078G1X41e-156A0A078G1X4_BRANA; BnaA09g07670D protein
STRINGBra037135.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22862874
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.16e-96Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]